GOLGA2 MaxPab rabbit polyclonal antibody (D01)
  • GOLGA2 MaxPab rabbit polyclonal antibody (D01)

GOLGA2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00002801-D01
GOLGA2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GOLGA2 protein.
Información adicional
Size 100 uL
Gene Name GOLGA2
Gene Alias GM130|MGC20672
Gene Description golgi autoantigen, golgin subfamily a, 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IP,IF
Immunogen Prot. Seq MSEETRQSKLAAAKKKLREYQQRNSPGVPTGAKKKKKIKNGSNPETTTSGGCHSPEDTPKDNAATLQPSDDTVLPGGVPSPGASLTSMAASQNHDADNVPNLMDETKTFSSTESLRQLSQQLNGLVCESATCVNGEGPASSANLKDLESRYQQLAVALDSSYVTNKQLNITIEKLKQQNQEITDQLEEEKKECHQKQGALREQLQVHIQTIGILVSEKAELQTALAHTQHAARQKEGESEDLASRLQYSRRRVGE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GOLGA2 (NP_004477.2, 1 a.a. ~ 990 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 2801

Enviar un mensaje


GOLGA2 MaxPab rabbit polyclonal antibody (D01)

GOLGA2 MaxPab rabbit polyclonal antibody (D01)