GNS purified MaxPab rabbit polyclonal antibody (D01P)
  • GNS purified MaxPab rabbit polyclonal antibody (D01P)

GNS purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002799-D01P
GNS purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GNS protein.
Información adicional
Size 100 ug
Gene Name GNS
Gene Alias G6S|MGC21274
Gene Description glucosamine (N-acetyl)-6-sulfatase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MRLLPLAPGRLRRGSPRHLPSCSPALLLLVLGGCLGVFGVAAGTRRPNVVLLLTDDQDEVLGGMTPLKKTKALIGEMGMTFSSAYVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSSKSWQKIQEPNTFPAILRSMCGYQTFFAGKYLNEYGAPDAGGLEHVPLGWSYWYALEKNSKYYNYTLSINGKARKHGENYSVDYLTDVLANVSLDFLDYKSNFEPFFMMIATPAPHSPWTAAPQYQKAFQNVFAPR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GNS (NP_002067.1, 1 a.a. ~ 552 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2799

Enviar un mensaje


GNS purified MaxPab rabbit polyclonal antibody (D01P)

GNS purified MaxPab rabbit polyclonal antibody (D01P)