GNG7 purified MaxPab rabbit polyclonal antibody (D01P)
  • GNG7 purified MaxPab rabbit polyclonal antibody (D01P)

GNG7 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002788-D01P
GNG7 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GNG7 protein.
Información adicional
Size 100 ug
Gene Name GNG7
Gene Alias FLJ00058
Gene Description guanine nucleotide binding protein (G protein), gamma 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GNG7 (NP_443079.1, 1 a.a. ~ 68 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2788

Enviar un mensaje


GNG7 purified MaxPab rabbit polyclonal antibody (D01P)

GNG7 purified MaxPab rabbit polyclonal antibody (D01P)