GNB2 polyclonal antibody (A01)
  • GNB2 polyclonal antibody (A01)

GNB2 polyclonal antibody (A01)

Ref: AB-H00002783-A01
GNB2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant GNB2.
Información adicional
Size 50 uL
Gene Name GNB2
Gene Alias -
Gene Description guanine nucleotide binding protein (G protein), beta polypeptide 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GNB2 (AAH10073, 1 a.a. ~ 340 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2783

Enviar un mensaje


GNB2 polyclonal antibody (A01)

GNB2 polyclonal antibody (A01)