GNAQ purified MaxPab mouse polyclonal antibody (B01P)
  • GNAQ purified MaxPab mouse polyclonal antibody (B01P)

GNAQ purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002776-B01P
GNAQ purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GNAQ protein.
Información adicional
Size 50 ug
Gene Name GNAQ
Gene Alias G-ALPHA-q|GAQ
Gene Description guanine nucleotide binding protein (G protein), q polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GNAQ (AAH57777, 1 a.a. ~ 359 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2776

Enviar un mensaje


GNAQ purified MaxPab mouse polyclonal antibody (B01P)

GNAQ purified MaxPab mouse polyclonal antibody (B01P)