GML monoclonal antibody (M01), clone 5F4
  • GML monoclonal antibody (M01), clone 5F4

GML monoclonal antibody (M01), clone 5F4

Ref: AB-H00002765-M01
GML monoclonal antibody (M01), clone 5F4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GML.
Información adicional
Size 100 ug
Gene Name GML
Gene Alias LY6DL
Gene Description glycosylphosphatidylinositol anchored molecule like protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq CPYHIRRCMTISIRINSRELLVYKNCTNNCTFVYAAEQPPEAPGKIFKTNSFYWVCCCNSMVCNAGGPTNLERDMLPDEVTEEELPEGTVRLGVSKLLLSFASIIVSNILP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GML (NP_002057, 48 a.a. ~ 158 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2765
Clone Number 5F4
Iso type IgG1 Kappa

Enviar un mensaje


GML monoclonal antibody (M01), clone 5F4

GML monoclonal antibody (M01), clone 5F4