GMDS purified MaxPab rabbit polyclonal antibody (D02P)
  • GMDS purified MaxPab rabbit polyclonal antibody (D02P)

GMDS purified MaxPab rabbit polyclonal antibody (D02P)

Ref: AB-H00002762-D02P
GMDS purified MaxPab rabbit polyclonal antibody (D02P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GMDS protein.
Información adicional
Size 100 ug
Gene Name GMDS
Gene Alias GMD|SDR3E1
Gene Description GDP-mannose 4,6-dehydratase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAHAPARCPSARGSGDGEMGKPRNVALITGITGQDGSYLAEFLLEKGYEVHGIVRRSSSFNTGRIEHLYKNPQAHIEGNMKLHYGDLTDSTCLVKIINEVKPTEIYNLGAQSHVKISFDLAEYTADVDGVGTLRLLDAVKTCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPRSPYGAAKLYAYWIVVNFREAYNLFAVNGILFNHESPRRGANFVTRKISRSVAKIYLGQLECFSLGNLDAKRDWGHAKDY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GMDS (NP_001491.1, 1 a.a. ~ 372 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2762

Enviar un mensaje


GMDS purified MaxPab rabbit polyclonal antibody (D02P)

GMDS purified MaxPab rabbit polyclonal antibody (D02P)