Ver mas grande
GMDS purified MaxPab rabbit polyclonal antibody (D02P)
AB-H00002762-D02P
Producto nuevo
GMDS purified MaxPab rabbit polyclonal antibody (D02P)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | GMDS |
| Gene Alias | GMD|SDR3E1 |
| Gene Description | GDP-mannose 4,6-dehydratase |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Tr |
| Immunogen Prot. Seq | MAHAPARCPSARGSGDGEMGKPRNVALITGITGQDGSYLAEFLLEKGYEVHGIVRRSSSFNTGRIEHLYKNPQAHIEGNMKLHYGDLTDSTCLVKIINEVKPTEIYNLGAQSHVKISFDLAEYTADVDGVGTLRLLDAVKTCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPRSPYGAAKLYAYWIVVNFREAYNLFAVNGILFNHESPRRGANFVTRKISRSVAKIYLGQLECFSLGNLDAKRDWGHAKDY |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | GMDS (NP_001491.1, 1 a.a. ~ 372 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 2762 |
Más información
Rabbit polyclonal antibody raised against a full-length human GMDS protein.