GLUL monoclonal antibody (M02J), clone 3B6
  • GLUL monoclonal antibody (M02J), clone 3B6

GLUL monoclonal antibody (M02J), clone 3B6

Ref: AB-H00002752-M02J
GLUL monoclonal antibody (M02J), clone 3B6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GLUL.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 100 ug
Gene Name GLUL
Gene Alias GLNS|GS|PIG43|PIG59
Gene Description glutamate-ammonia ligase (glutamine synthetase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq IEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GLUL (NP_002056.2, 274 a.a. ~ 373 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2752
Clone Number 3B6
Iso type IgG1 Kappa

Enviar un mensaje


GLUL monoclonal antibody (M02J), clone 3B6

GLUL monoclonal antibody (M02J), clone 3B6