GLUL monoclonal antibody (M01A), clone 2B12
  • GLUL monoclonal antibody (M01A), clone 2B12

GLUL monoclonal antibody (M01A), clone 2B12

Ref: AB-H00002752-M01A
GLUL monoclonal antibody (M01A), clone 2B12

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant GLUL.
Información adicional
Size 200 uL
Gene Name GLUL
Gene Alias GLNS|GS|PIG43|PIG59
Gene Description glutamate-ammonia ligase (glutamine synthetase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,ELISA
Immunogen Prot. Seq MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GLUL (AAH10037, 1 a.a. ~ 373 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 2752
Clone Number 2B12
Iso type IgG2a Kappa

Enviar un mensaje


GLUL monoclonal antibody (M01A), clone 2B12

GLUL monoclonal antibody (M01A), clone 2B12