GLUL purified MaxPab rabbit polyclonal antibody (D01P)
  • GLUL purified MaxPab rabbit polyclonal antibody (D01P)

GLUL purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002752-D01P
GLUL purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GLUL protein.
Información adicional
Size 100 ug
Gene Name GLUL
Gene Alias GLNS|GS|PIG43|PIG59
Gene Description glutamate-ammonia ligase (glutamine synthetase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GLUL (NP_002056.2, 1 a.a. ~ 373 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2752

Enviar un mensaje


GLUL purified MaxPab rabbit polyclonal antibody (D01P)

GLUL purified MaxPab rabbit polyclonal antibody (D01P)