GLUD2 purified MaxPab rabbit polyclonal antibody (D01P)
  • GLUD2 purified MaxPab rabbit polyclonal antibody (D01P)

GLUD2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002747-D01P
GLUD2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GLUD2 protein.
Información adicional
Size 100 ug
Gene Name GLUD2
Gene Alias GDH2|GLUDP1
Gene Description glutamate dehydrogenase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTPGFRDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSILEVDCDILIPAATEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNILVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLLSVQESLERKFGKHGGTIPIVPTAEFQDSISGASEKDIVHSALAYTMERSARQIMHTAMKYNLGLDLRTAAYVNAIEKVFKV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GLUD2 (AAH05111.1, 1 a.a. ~ 264 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2747

Enviar un mensaje


GLUD2 purified MaxPab rabbit polyclonal antibody (D01P)

GLUD2 purified MaxPab rabbit polyclonal antibody (D01P)