GLRX monoclonal antibody (M02), clone 3C11
  • GLRX monoclonal antibody (M02), clone 3C11

GLRX monoclonal antibody (M02), clone 3C11

Ref: AB-H00002745-M02
GLRX monoclonal antibody (M02), clone 3C11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GLRX.
Información adicional
Size 100 ug
Gene Name GLRX
Gene Alias GRX|GRX1|MGC117407
Gene Description glutaredoxin (thioltransferase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GLRX (AAH10965, 1 a.a. ~ 106 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2745
Clone Number 3C11
Iso type IgG2a Kappa

Enviar un mensaje


GLRX monoclonal antibody (M02), clone 3C11

GLRX monoclonal antibody (M02), clone 3C11