GLS monoclonal antibody (M03A), clone 5C9
  • GLS monoclonal antibody (M03A), clone 5C9

GLS monoclonal antibody (M03A), clone 5C9

Ref: AB-H00002744-M03A
GLS monoclonal antibody (M03A), clone 5C9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GLS.
Información adicional
Size 200 uL
Gene Name GLS
Gene Alias AAD20|DKFZp686O15119|FLJ10358|GLS1|KIAA0838
Gene Description glutaminase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GLS (NP_055720, 580 a.a. ~ 669 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 2744
Clone Number 5C9
Iso type IgG2a Kappa

Enviar un mensaje


GLS monoclonal antibody (M03A), clone 5C9

GLS monoclonal antibody (M03A), clone 5C9