GLS polyclonal antibody (A01)
  • GLS polyclonal antibody (A01)

GLS polyclonal antibody (A01)

Ref: AB-H00002744-A01
GLS polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GLS.
Información adicional
Size 50 uL
Gene Name GLS
Gene Alias AAD20|DKFZp686O15119|FLJ10358|GLS1|KIAA0838
Gene Description glutaminase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GLS (NP_055720, 580 a.a. ~ 669 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2744

Enviar un mensaje


GLS polyclonal antibody (A01)

GLS polyclonal antibody (A01)