GLRA1 monoclonal antibody (M07), clone 3G8 Ver mas grande

GLRA1 monoclonal antibody (M07), clone 3G8

AB-H00002741-M07

Producto nuevo

GLRA1 monoclonal antibody (M07), clone 3G8

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name GLRA1
Gene Alias MGC138878|MGC138879|STHE
Gene Description glycine receptor, alpha 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq IWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GLRA1 (NP_000162, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2741
Clone Number 3G8
Iso type IgG2a Kappa

Más información

Mouse monoclonal antibody raised against a partial recombinant GLRA1.

Consulta sobre un producto

GLRA1 monoclonal antibody (M07), clone 3G8

GLRA1 monoclonal antibody (M07), clone 3G8