GLB1 MaxPab rabbit polyclonal antibody (D01)
  • GLB1 MaxPab rabbit polyclonal antibody (D01)

GLB1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00002720-D01
GLB1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GLB1 protein.
Información adicional
Size 100 uL
Gene Name GLB1
Gene Alias EBP|ELNR1
Gene Description galactosidase, beta 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MPGFLVRILLLLLVLLLLGPTRGLRNATQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVILRPGPYICAEWEMGGLPAWLLEKESILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFLQKRFRHHLGDDVVLFTTDGAHKTFLKCGALQGLYTTVDFGTGSNITDAFLSQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GLB1 (AAH07493.1, 1 a.a. ~ 677 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 2720

Enviar un mensaje


GLB1 MaxPab rabbit polyclonal antibody (D01)

GLB1 MaxPab rabbit polyclonal antibody (D01)