GLA purified MaxPab rabbit polyclonal antibody (D01P)
  • GLA purified MaxPab rabbit polyclonal antibody (D01P)

GLA purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002717-D01P
GLA purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GLA protein.
Información adicional
Size 100 ug
Gene Name GLA
Gene Alias GALA
Gene Description galactosidase, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MQLRNPELHLGCALALRFLALVSWDIPGARALDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLFMEMAELMVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQKPNYTEIRQYCNHWRNFADIDDSWKSIKSILDWTSFNQERIVD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GLA (NP_000160.1, 1 a.a. ~ 429 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2717

Enviar un mensaje


GLA purified MaxPab rabbit polyclonal antibody (D01P)

GLA purified MaxPab rabbit polyclonal antibody (D01P)