GK purified MaxPab mouse polyclonal antibody (B01P)
  • GK purified MaxPab mouse polyclonal antibody (B01P)

GK purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002710-B01P
GK purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GK protein.
Información adicional
Size 50 ug
Gene Name GK
Gene Alias GK1|GKD
Gene Description glycerol kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IHC-P
Immunogen Prot. Seq MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQSTVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKAGALEGVPISG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GK (NP_000158.1, 1 a.a. ~ 524 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2710

Enviar un mensaje


GK purified MaxPab mouse polyclonal antibody (B01P)

GK purified MaxPab mouse polyclonal antibody (B01P)