GK polyclonal antibody (A01)
  • GK polyclonal antibody (A01)

GK polyclonal antibody (A01)

Ref: AB-H00002710-A01
GK polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GK.
Información adicional
Size 50 uL
Gene Name GK
Gene Alias GK1|GKD
Gene Description glycerol kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq AASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GK (NP_000158, 2 a.a. ~ 94 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2710

Enviar un mensaje


GK polyclonal antibody (A01)

GK polyclonal antibody (A01)