GHRH purified MaxPab mouse polyclonal antibody (B01P)
  • GHRH purified MaxPab mouse polyclonal antibody (B01P)

GHRH purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002691-B01P
GHRH purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GHRH protein.
Información adicional
Size 50 ug
Gene Name GHRH
Gene Alias GHRF|GRF|MGC119781
Gene Description growth hormone releasing hormone
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHSRNSQG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GHRH (NP_066567.1, 1 a.a. ~ 108 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2691

Enviar un mensaje


GHRH purified MaxPab mouse polyclonal antibody (B01P)

GHRH purified MaxPab mouse polyclonal antibody (B01P)