GH1 monoclonal antibody (M02), clone 8G6
  • GH1 monoclonal antibody (M02), clone 8G6

GH1 monoclonal antibody (M02), clone 8G6

Ref: AB-H00002688-M02
GH1 monoclonal antibody (M02), clone 8G6

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant GH1.
Información adicional
Size 100 ug
Gene Name GH1
Gene Alias GH|GH-N|GHN|hGH-N
Gene Description growth hormone 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GH1 (AAH75012.1, 1 a.a. ~ 217 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2688
Clone Number 8G6
Iso type IgG2a Kappa

Enviar un mensaje


GH1 monoclonal antibody (M02), clone 8G6

GH1 monoclonal antibody (M02), clone 8G6