GH1 purified MaxPab rabbit polyclonal antibody (D01P)
  • GH1 purified MaxPab rabbit polyclonal antibody (D01P)

GH1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002688-D01P
GH1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GH1 protein.
Información adicional
Size 100 ug
Gene Name GH1
Gene Alias GH|GH-N|GHN|hGH-N
Gene Description growth hormone 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GH1 (AAH75012.1, 1 a.a. ~ 217 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2688

Enviar un mensaje


GH1 purified MaxPab rabbit polyclonal antibody (D01P)

GH1 purified MaxPab rabbit polyclonal antibody (D01P)