GFAP monoclonal antibody (M06), clone 8H3
  • GFAP monoclonal antibody (M06), clone 8H3

GFAP monoclonal antibody (M06), clone 8H3

Ref: AB-H00002670-M06
GFAP monoclonal antibody (M06), clone 8H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GFAP.
Información adicional
Size 100 ug
Gene Name GFAP
Gene Alias FLJ45472
Gene Description glial fibrillary acidic protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GFAP (AAH41765, 131 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2670
Clone Number 8H3
Iso type IgG2b Kappa

Enviar un mensaje


GFAP monoclonal antibody (M06), clone 8H3

GFAP monoclonal antibody (M06), clone 8H3