GDF9 purified MaxPab mouse polyclonal antibody (B01P)
  • GDF9 purified MaxPab mouse polyclonal antibody (B01P)

GDF9 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002661-B01P
GDF9 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GDF9 protein.
Información adicional
Size 50 ug
Gene Name GDF9
Gene Alias -
Gene Description growth differentiation factor 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MARPNKFLLWFCCFAWLCFPISLGSQASGGEAQIAASAELESGAMPWSLLQHIDERDRAGLLPALFKVLSVGRGGSPRLQPDSRALHYMKKLYKTYATKEGIPKSNRSHLYNTVRLFTPCTRHKQAPGDQVTGILPSVELLFNLDRITTVEHLLKSVLLYNINNSVSFSSAVKCVCNLMIKEPKSSSRTLGRAPYSFTFNSQFEFGKKHKWIQIDVTSLLQPLVASNKRSIHMSINFTCMKDQLEHPSAQNGLFN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GDF9 (NP_005251, 1 a.a. ~ 454 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2661

Enviar un mensaje


GDF9 purified MaxPab mouse polyclonal antibody (B01P)

GDF9 purified MaxPab mouse polyclonal antibody (B01P)