GDF2 polyclonal antibody (A01)
  • GDF2 polyclonal antibody (A01)

GDF2 polyclonal antibody (A01)

Ref: AB-H00002658-A01
GDF2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GDF2.
Información adicional
Size 50 uL
Gene Name GDF2
Gene Alias BMP-9|BMP9
Gene Description growth differentiation factor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GDF2 (NP_057288, 320 a.a. ~ 419 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2658

Enviar un mensaje


GDF2 polyclonal antibody (A01)

GDF2 polyclonal antibody (A01)