GCSH monoclonal antibody (M02), clone M2
  • GCSH monoclonal antibody (M02), clone M2

GCSH monoclonal antibody (M02), clone M2

Ref: AB-H00002653-M02
GCSH monoclonal antibody (M02), clone M2

Información del producto

Mouse monoclonal antibody raised against a full length recombinant GCSH.
Información adicional
Size 100 ug
Gene Name GCSH
Gene Alias GCE|NKH
Gene Description glycine cleavage system protein H (aminomethyl carrier)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MALRVVRSVRALLCTLRAVPLPAAPCPPRPWQLGVGAVRTLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GCSH (AAH00790.1, 1 a.a. ~ 173 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2653
Clone Number M2
Iso type IgG1 Kappa

Enviar un mensaje


GCSH monoclonal antibody (M02), clone M2

GCSH monoclonal antibody (M02), clone M2