GCSH polyclonal antibody (A01)
  • GCSH polyclonal antibody (A01)

GCSH polyclonal antibody (A01)

Ref: AB-H00002653-A01
GCSH polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant GCSH.
Información adicional
Size 50 uL
Gene Name GCSH
Gene Alias GCE|NKH
Gene Description glycine cleavage system protein H (aminomethyl carrier)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MALRVVRSVRALLCTLRAVPLPAAPCPPRPWQLGVGAVRTLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GCSH (AAH00790.1, 1 a.a. ~ 173 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2653

Enviar un mensaje


GCSH polyclonal antibody (A01)

GCSH polyclonal antibody (A01)