GCNT2 purified MaxPab mouse polyclonal antibody (B01P)
  • GCNT2 purified MaxPab mouse polyclonal antibody (B01P)

GCNT2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002651-B01P
GCNT2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GCNT2 protein.
Información adicional
Size 50 ug
Gene Name GCNT2
Gene Alias CCAT|GCNT2C|GCNT5|IGNT|II|MGC163396|NACGT1|NAGCT1|ULG3|bA360O19.2|bA421M1.1
Gene Description glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MNFWRYCFFAFTLLSVVIFVRFYSSQLSPPKSYEKLNSSSERYFRKTACNHALEKMPVFLWENILPSPLRSVPCKDYLTQNHYITSPLSEEEAAFPLAYVMVIHKDFDTFERLFRAIYMPQNVYCVHVDEKAPAEYKESVRQLLSCFQNAFIASKTESVVYAGISRLQADLNCLKDLVASEVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GCNT2 (NP_663630.2, 1 a.a. ~ 402 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2651

Enviar un mensaje


GCNT2 purified MaxPab mouse polyclonal antibody (B01P)

GCNT2 purified MaxPab mouse polyclonal antibody (B01P)