NR6A1 purified MaxPab rabbit polyclonal antibody (D01P)
  • NR6A1 purified MaxPab rabbit polyclonal antibody (D01P)

NR6A1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002649-D01P
NR6A1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NR6A1 protein.
Información adicional
Size 100 ug
Gene Name NR6A1
Gene Alias GCNF|GCNF1|NR61|RTR
Gene Description nuclear receptor subfamily 6, group A, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MERDEPPPSGGGGGGGSAGFLEPPAALPPPPRNGFCQDELAELDPGTNDRAEQRTCLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNCVMSRKQRNRCQYCRLLKCLQMGMNRKAIREDGMPGGRNKSIGPVQISEEEIERIMSGQEFEEEANHWSNHGDSDHSSPGNRASESNQPSPGSTLSSRSVELNGFMAFREQYMGMSVPPHYQYIPHLFSYSGHSPLLPQQARSLDPQSYSLIHQLLSA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NR6A1 (NP_001480.3, 1 a.a. ~ 475 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2649

Enviar un mensaje


NR6A1 purified MaxPab rabbit polyclonal antibody (D01P)

NR6A1 purified MaxPab rabbit polyclonal antibody (D01P)