GCHFR purified MaxPab rabbit polyclonal antibody (D01P)
  • GCHFR purified MaxPab rabbit polyclonal antibody (D01P)

GCHFR purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002644-D01P
GCHFR purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GCHFR protein.
Información adicional
Size 100 ug
Gene Name GCHFR
Gene Alias GFRP|HsT16933|MGC138467|MGC138469|P35
Gene Description GTP cyclohydrolase I feedback regulator
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GCHFR (NP_005249.1, 1 a.a. ~ 84 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2644

Enviar un mensaje


GCHFR purified MaxPab rabbit polyclonal antibody (D01P)

GCHFR purified MaxPab rabbit polyclonal antibody (D01P)