GBX2 monoclonal antibody (M10), clone 2A9
  • GBX2 monoclonal antibody (M10), clone 2A9

GBX2 monoclonal antibody (M10), clone 2A9

Ref: AB-H00002637-M10
GBX2 monoclonal antibody (M10), clone 2A9

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant GBX2.
Información adicional
Size 100 ug
Gene Name GBX2
Gene Alias -
Gene Description gastrulation brain homeobox 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEE*
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GBX2 (NP_001476, 141 a.a. ~ 230 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2637
Clone Number 2A9
Iso type IgG2a Kappa

Enviar un mensaje


GBX2 monoclonal antibody (M10), clone 2A9

GBX2 monoclonal antibody (M10), clone 2A9