GBP2 monoclonal antibody (M03), clone 2A10
  • GBP2 monoclonal antibody (M03), clone 2A10

GBP2 monoclonal antibody (M03), clone 2A10

Ref: AB-H00002634-M03
GBP2 monoclonal antibody (M03), clone 2A10

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant GBP2.
Información adicional
Size 100 ug
Gene Name GBP2
Gene Alias -
Gene Description guanylate binding protein 2, interferon-inducible
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,ELISA
Immunogen Prot. Seq MAPEINLPGPMSLIDNTKGQLVVNPEALKILSAITQPVVVVAIVGLYRTGKSYLMNKLAGKKNGFSLGSTVKSHTKGIWMWCVPHPKKPEHTLVLLDTEGLGDIEKGDNENDSWIFALAILLSSTFVYNSMGTINQQAMDQLHYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTLRDFTLELEVDGEPITADDYLELSLKLRKGTDKKSKSFNDPRLCIRKFFPKRKCFVFDWPAPKKYLAHLEQLKEEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GBP2 (AAH22272, 1 a.a. ~ 481 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2634
Clone Number 2A10
Iso type IgG2a Kappa

Enviar un mensaje


GBP2 monoclonal antibody (M03), clone 2A10

GBP2 monoclonal antibody (M03), clone 2A10