GBA MaxPab rabbit polyclonal antibody (D01)
  • GBA MaxPab rabbit polyclonal antibody (D01)

GBA MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00002629-D01
GBA MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GBA protein.
Información adicional
Size 100 uL
Gene Name GBA
Gene Alias GBA1|GCB|GLUC
Gene Description glucosidase, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MEFSSPSREECPKPLSRVSIMAGSLTGLLLLQAVSWASGARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRRMELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGSLKGQPGDIYHQTWARYFVKF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GBA (AAH03356.1, 1 a.a. ~ 536 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 2629

Enviar un mensaje


GBA MaxPab rabbit polyclonal antibody (D01)

GBA MaxPab rabbit polyclonal antibody (D01)