GATM monoclonal antibody (M08A), clone 2H7
  • GATM monoclonal antibody (M08A), clone 2H7

GATM monoclonal antibody (M08A), clone 2H7

Ref: AB-H00002628-M08A
GATM monoclonal antibody (M08A), clone 2H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GATM.
Información adicional
Size 200 uL
Gene Name GATM
Gene Alias AGAT|AT
Gene Description glycine amidinotransferase (L-arginine:glycine amidinotransferase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MLRVRCLRGGSRGAEAVHYIGSRLGRTLTGWVQRTFQSTQAATASSRNSCAADDKATEPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTIEVKANTY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GATM (NP_001473.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 2628
Clone Number 2H7
Iso type IgM Kappa

Enviar un mensaje


GATM monoclonal antibody (M08A), clone 2H7

GATM monoclonal antibody (M08A), clone 2H7