GATA2 monoclonal antibody (M05), clone 1A5
  • GATA2 monoclonal antibody (M05), clone 1A5

GATA2 monoclonal antibody (M05), clone 1A5

Ref: AB-H00002624-M05
GATA2 monoclonal antibody (M05), clone 1A5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GATA2.
Información adicional
Size 50 ug
Gene Name GATA2
Gene Alias MGC2306|NFE1B
Gene Description GATA binding protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GATA2 (AAH18988, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2624
Clone Number 1A5
Iso type IgG2b Kappa

Enviar un mensaje


GATA2 monoclonal antibody (M05), clone 1A5

GATA2 monoclonal antibody (M05), clone 1A5