GATA2 purified MaxPab rabbit polyclonal antibody (D01P)
  • GATA2 purified MaxPab rabbit polyclonal antibody (D01P)

GATA2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002624-D01P
GATA2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GATA2 protein.
Información adicional
Size 100 ug
Gene Name GATA2
Gene Alias MGC2306|NFE1B
Gene Description GATA binding protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GATA2 (NP_116027.2, 1 a.a. ~ 480 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2624

Enviar un mensaje


GATA2 purified MaxPab rabbit polyclonal antibody (D01P)

GATA2 purified MaxPab rabbit polyclonal antibody (D01P)