GAS6 polyclonal antibody (A01)
  • GAS6 polyclonal antibody (A01)

GAS6 polyclonal antibody (A01)

Ref: AB-H00002621-A01
GAS6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GAS6.
Información adicional
Size 50 uL
Gene Name GAS6
Gene Alias AXLLG|AXSF|DKFZp666G247|FLJ34709
Gene Description growth arrest-specific 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VSLRDGEATLEVDGTRGQSEVSAAQLQERLAVLERHLRSPVLTFAGGLPDVPVTSAPVTAFYRGCMTLEVNRRLLDLDEAAYKHSDITAHSCPPVEPAAA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GAS6 (NP_000811, 579 a.a. ~ 678 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2621

Enviar un mensaje


GAS6 polyclonal antibody (A01)

GAS6 polyclonal antibody (A01)