GAS2 monoclonal antibody (M01), clone 4E11
  • GAS2 monoclonal antibody (M01), clone 4E11

GAS2 monoclonal antibody (M01), clone 4E11

Ref: AB-H00002620-M01
GAS2 monoclonal antibody (M01), clone 4E11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GAS2.
Información adicional
Size 100 ug
Gene Name GAS2
Gene Alias MGC32610
Gene Description growth arrest-specific 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFAR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GAS2 (NP_005247, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2620
Clone Number 4E11
Iso type IgG2a Kappa

Enviar un mensaje


GAS2 monoclonal antibody (M01), clone 4E11

GAS2 monoclonal antibody (M01), clone 4E11