GAS2 polyclonal antibody (A01)
  • GAS2 polyclonal antibody (A01)

GAS2 polyclonal antibody (A01)

Ref: AB-H00002620-A01
GAS2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GAS2.
Información adicional
Size 50 uL
Gene Name GAS2
Gene Alias MGC32610
Gene Description growth arrest-specific 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFAR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GAS2 (NP_005247, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2620

Enviar un mensaje


GAS2 polyclonal antibody (A01)

GAS2 polyclonal antibody (A01)