GAPDH monoclonal antibody (M01), clone 3C2
  • GAPDH monoclonal antibody (M01), clone 3C2

GAPDH monoclonal antibody (M01), clone 3C2

Ref: AB-H00002597-M01
GAPDH monoclonal antibody (M01), clone 3C2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GAPDH.
Información adicional
Size 100 ug
Gene Name GAPDH
Gene Alias G3PD|GAPD|MGC88685
Gene Description glyceraldehyde-3-phosphate dehydrogenase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GAPDH (NP_002037, 226 a.a. ~ 335 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2597
Clone Number 3C2
Iso type IgG1 Kappa

Enviar un mensaje


GAPDH monoclonal antibody (M01), clone 3C2

GAPDH monoclonal antibody (M01), clone 3C2