GAPDH polyclonal antibody (A01)
  • GAPDH polyclonal antibody (A01)

GAPDH polyclonal antibody (A01)

Ref: AB-H00002597-A01
GAPDH polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GAPDH.
Información adicional
Size 50 uL
Gene Name GAPDH
Gene Alias G3PD|GAPD|MGC88685
Gene Description glyceraldehyde-3-phosphate dehydrogenase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GAPDH (NP_002037, 226 a.a. ~ 335 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2597

Enviar un mensaje


GAPDH polyclonal antibody (A01)

GAPDH polyclonal antibody (A01)