GAP43 purified MaxPab rabbit polyclonal antibody (D01P)
  • GAP43 purified MaxPab rabbit polyclonal antibody (D01P)

GAP43 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002596-D01P
GAP43 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GAP43 protein.
Información adicional
Size 100 ug
Gene Name GAP43
Gene Alias B-50|PP46
Gene Description growth associated protein 43
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GAP43 (NP_002036.1, 1 a.a. ~ 238 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2596

Enviar un mensaje


GAP43 purified MaxPab rabbit polyclonal antibody (D01P)

GAP43 purified MaxPab rabbit polyclonal antibody (D01P)