GALNT1 polyclonal antibody (A01)
  • GALNT1 polyclonal antibody (A01)

GALNT1 polyclonal antibody (A01)

Ref: AB-H00002589-A01
GALNT1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GALNT1.
Información adicional
Size 50 uL
Gene Name GALNT1
Gene Alias GALNAC-T1
Gene Description UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GALNT1 (NP_065207, 42 a.a. ~ 123 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2589

Enviar un mensaje


GALNT1 polyclonal antibody (A01)

GALNT1 polyclonal antibody (A01)