GALK1 polyclonal antibody (A02)
  • GALK1 polyclonal antibody (A02)

GALK1 polyclonal antibody (A02)

Ref: AB-H00002584-A02
GALK1 polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GALK1.
Información adicional
Size 50 uL
Gene Name GALK1
Gene Alias GALK|GK1
Gene Description galactokinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq PCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRAR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GALK1 (NP_000145, 181 a.a. ~ 279 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2584

Enviar un mensaje


GALK1 polyclonal antibody (A02)

GALK1 polyclonal antibody (A02)