GAB1 monoclonal antibody (M01), clone 1B3
  • GAB1 monoclonal antibody (M01), clone 1B3

GAB1 monoclonal antibody (M01), clone 1B3

Ref: AB-H00002549-M01
GAB1 monoclonal antibody (M01), clone 1B3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GAB1.
Información adicional
Size 100 ug
Gene Name GAB1
Gene Alias -
Gene Description GRB2-associated binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,PLA-Ce,IF
Immunogen Prot. Seq NLSSEDPNLFGSNSLDGGSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPPKSVK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GAB1 (NP_997006, 625 a.a. ~ 724 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2549
Clone Number 1B3
Iso type IgG2a Kappa

Enviar un mensaje


GAB1 monoclonal antibody (M01), clone 1B3

GAB1 monoclonal antibody (M01), clone 1B3