SLC37A4 monoclonal antibody (M01), clone 7B9
  • SLC37A4 monoclonal antibody (M01), clone 7B9

SLC37A4 monoclonal antibody (M01), clone 7B9

Ref: AB-H00002542-M01
SLC37A4 monoclonal antibody (M01), clone 7B9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC37A4.
Información adicional
Size 100 ug
Gene Name SLC37A4
Gene Alias G6PT1|G6PT2|G6PT3|GSD1b|GSD1c|GSD1d|MGC15729|PRO0685|TRG19
Gene Description solute carrier family 37 (glucose-6-phosphate transporter), member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC37A4 (NP_001458.1, 28 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2542
Clone Number 7B9
Iso type IgG2a Kappa

Enviar un mensaje


SLC37A4 monoclonal antibody (M01), clone 7B9

SLC37A4 monoclonal antibody (M01), clone 7B9