FYN monoclonal antibody (M03), clone 1A3
  • FYN monoclonal antibody (M03), clone 1A3

FYN monoclonal antibody (M03), clone 1A3

Ref: AB-H00002534-M03
FYN monoclonal antibody (M03), clone 1A3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FYN.
Información adicional
Size 100 ug
Gene Name FYN
Gene Alias MGC45350|SLK|SYN
Gene Description FYN oncogene related to SRC, FGR, YES
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGTLRTRGGTGVTLFVAL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FYN (AAH32496, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2534
Clone Number 1A3
Iso type IgG2b Kappa

Enviar un mensaje


FYN monoclonal antibody (M03), clone 1A3

FYN monoclonal antibody (M03), clone 1A3