DARC purified MaxPab rabbit polyclonal antibody (D01P)
  • DARC purified MaxPab rabbit polyclonal antibody (D01P)

DARC purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002532-D01P
DARC purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DARC protein.
Información adicional
Size 100 ug
Gene Name DARC
Gene Alias CCBP1|CD234|Dfy|FY|GPD|GpFy|WBCQ1
Gene Description Duffy blood group, chemokine receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DARC (NP_002027.2, 1 a.a. ~ 336 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2532

Enviar un mensaje


DARC purified MaxPab rabbit polyclonal antibody (D01P)

DARC purified MaxPab rabbit polyclonal antibody (D01P)