FUT7 monoclonal antibody (M03), clone 1C12
  • FUT7 monoclonal antibody (M03), clone 1C12

FUT7 monoclonal antibody (M03), clone 1C12

Ref: AB-H00002529-M03
FUT7 monoclonal antibody (M03), clone 1C12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FUT7.
Información adicional
Size 100 ug
Gene Name FUT7
Gene Alias FucT-VII
Gene Description fucosyltransferase 7 (alpha (1,3) fucosyltransferase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq YEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFAWRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FUT7 (NP_004470, 262 a.a. ~ 342 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2529
Clone Number 1C12
Iso type IgG2a Kappa

Enviar un mensaje


FUT7 monoclonal antibody (M03), clone 1C12

FUT7 monoclonal antibody (M03), clone 1C12