FUT6 purified MaxPab mouse polyclonal antibody (B01P)
  • FUT6 purified MaxPab mouse polyclonal antibody (B01P)

FUT6 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002528-B01P
FUT6 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FUT6 protein.
Información adicional
Size 50 ug
Gene Name FUT6
Gene Alias FCT3A|FLJ40754|FT1A|FucT-VI
Gene Description fucosyltransferase 6 (alpha (1,3) fucosyltransferase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDPLGPAKPQWSWRCCLTTLLFHLLMAVCFFSYLRVSQDDPTVYPNGSRFPDSTGTPAHSIPLILLWTWPFNKPIALPRCSEMVPGTADCNITADRKVYPQADAVIVHHREVMYNPSAQLPRSSRRQGQRWIWFSMESPSHCWQLKAMDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWGPNSARVRYYQSLQAHLKVDVYGRSHKPLPQGTMMETLSRYKFYLAFKNSLHPDYI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FUT6 (AAH61700.1, 1 a.a. ~ 359 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2528

Enviar un mensaje


FUT6 purified MaxPab mouse polyclonal antibody (B01P)

FUT6 purified MaxPab mouse polyclonal antibody (B01P)